Structure of PDB 8x15 Chain J Binding Site BS01

Receptor Information
>8x15 Chain J (length=158) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RQSTAEHTRQTFLRVQERQGQSRRRKGPHCERPLTQEELLREAKITEELN
LRSLETYERLEADKKKQVHKKRKCPGPIITYHSVTVPRCSRTFITFSDDA
TFEEWFPQGRPPKVPVREVCPVTHRPALYRDPVTDIPYATARAFKIIREA
YKKYITAH
Ligand information
>8x15 Chain Y (length=137) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cccggtgccgaggccgctcaattggtcgtagacagctctagcaccgctta
aacgcacgtacgcgctgtcccccgcgttttaaccgccaaggggattactc
cctagtctccaggcacgtgtcacatatatacatcctg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8x15 Structure of nucleosome-bound SRCAP-C in the apo state
Resolution3.2 Å
Binding residue
(original residue number in PDB)		K159 P161
Binding residue
(residue number reindexed from 1)		K26 P28
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0042393 histone binding
GO:0140713 histone chaperone activity
GO:0140849 ATP-dependent H2AZ histone chaperone activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0006355 regulation of DNA-templated transcription
GO:0035019 somatic stem cell population maintenance
GO:0042981 regulation of apoptotic process
GO:0045815 transcription initiation-coupled chromatin remodeling
GO:0045893 positive regulation of DNA-templated transcription
GO:0051726 regulation of cell cycle
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:2000779 regulation of double-strand break repair
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0016607 nuclear speck
GO:0032991 protein-containing complex
GO:0035267 NuA4 histone acetyltransferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8x15, PDBe:8x15, PDBj:8x15
PDBsum8x15
PubMed38331872
UniProtQ15906|VPS72_HUMAN Vacuolar protein sorting-associated protein 72 homolog (Gene Name=VPS72)

[Back to BioLiP]