Structure of PDB 8ugq Chain J Binding Site BS01

Receptor Information
>8ugq Chain J (length=215) Species: 10823 (Maize streak virus - [Nigeria]) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRAGSKADRPSLQIQTLQHAGTTMITVPSGGVCDLINTYARGSDEGNRHT
SETLTYKIAIDYHFVADAAACRYSNTGTGVMWLVYDTTPGGQAPTPQTIF
AYPDTLKAWPATWKVSRELCHRFVVKRRWLFNMETDGRIGSDIPPSNASW
KPCKRNIYFHKFTSGLGVRTQWKNVTDGGVGAIQRGALYMVIAPGNGLTF
TAHGQTRLYFKSVGN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ugq The two states of Maize Streak Virus (MSV) Geminivirus Architecture
Resolution3.17 Å
Binding residue
(original residue number in PDB)
K34 K142 R145 H149 V153
Binding residue
(residue number reindexed from 1)
K6 K114 R117 H121 V125
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005198 structural molecule activity
Biological Process
GO:0046718 symbiont entry into host cell
GO:0075732 viral penetration into host nucleus
Cellular Component
GO:0019028 viral capsid
GO:0039615 T=1 icosahedral viral capsid
GO:0042025 host cell nucleus
GO:0043657 host cell

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8ugq, PDBe:8ugq, PDBj:8ugq
PDBsum8ugq
PubMed
UniProtP06448|CAPSD_MSVN Capsid protein (Gene Name=V1)

[Back to BioLiP]