Structure of PDB 8sbl Chain J Binding Site BS01

Receptor Information
>8sbl Chain J (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFG
CDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAA
HVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8sbl Structural principles of peptide-centric chimeric antigen receptor recognition guide therapeutic expansion
Resolution3.0 Å
Binding residue
(original residue number in PDB)
Y7 E63 K66 H70 T73 N77 I80 Y84 F99 T143 K146 W147 V152 Q156 Y159 Y171
Binding residue
(residue number reindexed from 1)
Y7 E63 K66 H70 T73 N77 I80 Y84 F99 T143 K146 W147 V152 Q156 Y159 Y171
Enzymatic activity
Enzyme Commision number ?
External links