Structure of PDB 8qzs Chain J Binding Site BS01

Receptor Information
>8qzs Chain J (length=224) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVL
GTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKE
DISQGVHISVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVE
GGPKAQKKFKRLMLHRIKNKCVLVWEGTAKDRSFGEMKFKQCPTENMARE
HFKKHGAEHYWDLALSESVLESTD
Ligand information
>8qzs Chain 6 (length=59) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acgauacagagaagauuagcauggccccugcgcaaggaugacauucguga
agcguauuu
..................................................
.........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qzs Structural insights into the cross-exon to cross-intron spliceosome switch
Resolution4.1 Å
Binding residue
(original residue number in PDB)		K475 N515 R518 K519 P554
Binding residue
(residue number reindexed from 1)		K40 N80 R83 K84 P119
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000375 RNA splicing, via transesterification reactions
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005829 cytosol
GO:0015030 Cajal body
GO:0016607 nuclear speck
GO:0032991 protein-containing complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qzs, PDBe:8qzs, PDBj:8qzs
PDBsum8qzs
PubMed38778104
UniProtO43395|PRPF3_HUMAN U4/U6 small nuclear ribonucleoprotein Prp3 (Gene Name=PRPF3)

[Back to BioLiP]