Structure of PDB 8qpa Chain J Binding Site BS01

Receptor Information

>8qpa Chain J (length=85) Species: 9606 (Homo sapiens)

LGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVL
GTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKL

Ligand information

>8qpa Chain 4 (length=62)

agcuuugcgcaguggcaguaucguagccaaugaggucuauccgaggcgcg
auuauugcuaau

...................<<<<<.<<<.....<<.....>>..>>>>>>
>>..........

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8qpa Structural insights into the cross-exon to cross-intron spliceosome switch
• Resolution: 3.7 Å
• Binding residue (original residue number in PDB): R450 Q461 R477 R507 H511 R518
• Binding residue (residue number reindexed from 1): R15 Q26 R42 R72 H76 R83

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0042802 identical protein binding

Biological Process

• GO:0000244 spliceosomal tri-snRNP complex assembly
• GO:0000375 RNA splicing, via transesterification reactions
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005829 cytosol
• GO:0015030 Cajal body
• GO:0016607 nuclear speck
• GO:0032991 protein-containing complex
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071005 U2-type precatalytic spliceosome

External links

• PDB: RCSB:8qpa, PDBe:8qpa, PDBj:8qpa
• PDBsum: 8qpa
• PubMed: 38778104
• UniProt: O43395|PRPF3_HUMAN U4/U6 small nuclear ribonucleoprotein Prp3 (Gene Name=PRPF3)