Structure of PDB 8qlp Chain J Binding Site BS01

Receptor Information
>8qlp Chain J (length=452) Species: 1904864 (Bacillales bacterium) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKELIYIHEPNILFANGQKCADPRDGLALFGPFTKIYGIKSGVVGTQYGL
SIFKNYINHIQKPIYNANNITRPMFPGFEAVFGCKWDADNVVFKEVTKEE
IEKILYTESNHKRTYDLVSLFINKIITANKNEDEKVDVWFLVIPDEIYQY
CRAQFHDQLKARLLEHTIPTQILRESTLAWRDFKNKFGAPKRDFSKIEGH
LAWTISTAAFYKAGGKPWKLSDIRSGVCYLGLVYKQIEPKNACCAAQMFL
DNGDGTVFKGEVGPWYNQEKHEFHLNPKEAKALLTQALNSYKEQNGVFPK
EIFIHAKTKFNGQEWNAFQEVTPEGTNLVGVTITKTKPLKLFKSEGNYPI
MRGNAFIVNERSAFLWTVGYVPKTESTLSMEVPNPIFIEINKGEADIEQV
LKDVLALTKLNYNACIYADGVPVTLRFADKIGEILTASTELKAPPLAFKY
YI
Ligand information
>8qlp Chain K (length=21) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugacggcucuaaucuauuagu
.....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qlp Target DNA-dependent activation mechanism of the prokaryotic immune system SPARTA.
Resolution3.14 Å
Binding residue
(original residue number in PDB)		Y148 Q205 H207 K211 Q222 I223 R225 T228 R243 H251 L252 T255 K325 H326 E327 N439 N468 A469 I471 G475 R481 I507
Binding residue
(residue number reindexed from 1)		Y148 Q154 H156 K160 Q171 I172 R174 T177 R192 H200 L201 T204 K270 H271 E272 N384 N413 A414 I416 G420 R426 I452
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Nov 25 09:21:31 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8qlp', asym_id = 'J', bs = 'BS01', title = 'Target DNA-dependent activation mechanism of the prokaryotic immune system SPARTA.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8qlp', asym_id='J', bs='BS01', title='Target DNA-dependent activation mechanism of the prokaryotic immune system SPARTA.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003676', uniprot = '', pdbid = '8qlp', asym_id = 'J'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676', uniprot='', pdbid='8qlp', asym_id='J')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>