Structure of PDB 8pn4 Chain J Binding Site BS01

Receptor Information
>8pn4 Chain J (length=58) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQ
NRRTKWKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pn4 transcription factor BARHL2 bound to DNA sequences
Resolution2.6 Å
Binding residue
(original residue number in PDB)
R233 K234 R236 T237 F239 W279 N282 K286
Binding residue
(residue number reindexed from 1)
R2 K3 R5 T6 F8 W48 N51 K55
External links
PDB RCSB:8pn4, PDBe:8pn4, PDBj:8pn4
PDBsum8pn4
PubMed
UniProtQ9NY43|BARH2_HUMAN BarH-like 2 homeobox protein (Gene Name=BARHL2)

[Back to BioLiP]