Structure of PDB 8ovc Chain J Binding Site BS01

Receptor Information
>8ovc Chain J (length=186) Species: 1772 (Mycolicibacterium smegmatis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLNRPNMVSVGTIVWLSSELMFFAGLFAMYFTARAQAGGAWPPEPTELNL
ALAVPVTLVLIASSFTCQMGVFAAERGDVFGLRRWYVITFLMGLFFVLGQ
GYEYIHLVEHGTTIPGSAYGSVFYLATGFHGLHVIGGLVAFVLLLARTKM
SKFTPAQATAAIVVSYYWHFVDIVWIALFATIYFVR
Ligand information
>8ovc Chain e (length=23) Species: 1772 (Mycolicibacterium smegmatis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ovc Long-range charge transfer mechanism of the III 2 IV 2 mycobacterial supercomplex.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		L19 R21 N23 M24 E92 K169 T171 I179
Binding residue
(residue number reindexed from 1)		L2 R4 N6 M7 E75 K152 T154 I162
Gene Ontology
Molecular Function
GO:0004129 cytochrome-c oxidase activity
GO:0016491 oxidoreductase activity
Biological Process
GO:0009060 aerobic respiration
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ovc, PDBe:8ovc, PDBj:8ovc
PDBsum8ovc
PubMed38902248
UniProtA0R049

[Back to BioLiP]