Structure of PDB 8ouf Chain J Binding Site BS01

Receptor Information

>8ouf Chain J (length=64) Species: 9606 (Homo sapiens)

MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK
RFKVLMTQQPRPVL

Ligand information

>8ouf Chain B (length=86)

ccugcggcggccgcaggaagaggaacggagcgagucccgggcgcgucccu
gagcugugggacgugcccaggacucgcucacacaug

<<<<<<<<.>>>>>>>>..........<<<<<<<<<<.<<<<<<<<<<<.
.......>>>>>>>>>>>.>>>>>>>>>>.......

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8ouf 2.7 angstrom cryo-EM structure of human telomerase H/ACA ribonucleoprotein.
• Resolution: 3.1 Å
• Binding residue (original residue number in PDB): R34 S36
• Binding residue (residue number reindexed from 1): R34 S36

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0030515 snoRNA binding
• GO:0034513 box H/ACA snoRNA binding
• GO:0070034 telomerase RNA binding

Biological Process

• GO:0001522 pseudouridine synthesis
• GO:0006364 rRNA processing
• GO:0007004 telomere maintenance via telomerase
• GO:0031118 rRNA pseudouridine synthesis
• GO:0031120 snRNA pseudouridine synthesis
• GO:0042254 ribosome biogenesis
• GO:0090671 telomerase RNA localization to Cajal body

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005697 telomerase holoenzyme complex
• GO:0005730 nucleolus
• GO:0005732 sno(s)RNA-containing ribonucleoprotein complex
• GO:0015030 Cajal body
• GO:0016604 nuclear body
• GO:0031429 box H/ACA snoRNP complex
• GO:0072589 box H/ACA scaRNP complex
• GO:0090661 box H/ACA telomerase RNP complex
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ouf, PDBe:8ouf, PDBj:8ouf
• PDBsum: 8ouf
• PubMed: 38272871
• UniProt: Q9NPE3|NOP10_HUMAN H/ACA ribonucleoprotein complex subunit 3 (Gene Name=NOP10)