Structure of PDB 8i0t Chain J Binding Site BS01

Receptor Information
>8i0t Chain J (length=249) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIY
ERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYK
YTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVDRARTI
YERFVLVHPDVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHL
YVAFAKFEENQKEFERVRVIYKYALDRISKQELFKNYTIFEKKFGDRRG
Ligand information
>8i0t Chain F (length=97) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugcucgcuucggcagcacauauacuaaaauuggaacgauacagagaaga
uuagcauggccccugcgcaaggaugacacgcaaauucgugaagcguu
<<<<<.<......>>>>>>...............................
......<<...<<<.....>>>....>>...................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i0t Molecular basis for the activation of human spliceosome
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R236 S243 Y318 S348 N351 R384
Binding residue
(residue number reindexed from 1)		R21 S28 Y103 S133 N136 R169
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0016607 nuclear speck
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0071014 post-mRNA release spliceosomal complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8i0t, PDBe:8i0t, PDBj:8i0t
PDBsum8i0t
PubMed39068178
UniProtQ9BZJ0|CRNL1_HUMAN Crooked neck-like protein 1 (Gene Name=CRNKL1)

[Back to BioLiP]