Structure of PDB 8fcu Chain J Binding Site BS01

Receptor Information
>8fcu Chain J (length=109) Species: 2014529 (Nostoc sp. 'Peltigera membranacea cyanobiont' 210A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSEEDKQYLIFIKVFQQAMKGNFAKIYAKTEEGKDPPIKKKVERLRAELN
YCYDELSFKEYLSDFLVRGGLNKYFNEHQEEIALLIKKSPWQEIRIWSLL
AIASYKPKD
Ligand information
>8fcu Chain N (length=63) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atctacgcgtagatatatctacgtttaacagtggccttattaaatgactt
ctccatgatctac
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fcu Molecular mechanism for Tn7-like transposon recruitment by a type I-B CRISPR effector.
Resolution3.19 Å
Binding residue
(original residue number in PDB)		A31 K32 K43 E46 R47 A50
Binding residue
(residue number reindexed from 1)		A28 K29 K40 E43 R44 A47
Enzymatic activity
Enzyme Commision number ?
External links