Structure of PDB 8e73 Chain J Binding Site BS01

Receptor Information
>8e73 Chain J (length=58) Species: 157791 (Vigna radiata) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GIFESLYKVVMRRNSVYVTFVIAGAFLGERAVDYGIHKLWEANNVGKRYE
DIPVLGQK
Ligand information
>8e73 Chain K (length=24) Species: 157791 (Vigna radiata) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DVKAAAMWGVAAATGGLYLVQVSI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e73 Plant-specific features of respiratory supercomplex I + III 2 from Vigna radiata.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		S25 T29 I32 F36 R40
Binding residue
(residue number reindexed from 1)		S15 T19 I22 F26 R30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0016020 membrane
GO:0045275 respiratory chain complex III

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8e73, PDBe:8e73, PDBj:8e73
PDBsum8e73
PubMed36581760
UniProtA0A1S3TQD2

[Back to BioLiP]