Structure of PDB 8dfa Chain J Binding Site BS01

Receptor Information
>8dfa Chain J (length=117) Species: 882 (Nitratidesulfovibrio vulgaris str. Hildenborough) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSLDPARTDRPYLLGRLFAVLEKAQEDAVPGANATIKDRYLASASANPGQ
VFHMLLKNASNHTAKLRKDPERKAIHYEIMMQEIIDNISDFPVTMSSDEQ
GLFMIGYYHQRKALFTK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dfa Structural snapshots of R-loop formation by a type I-C CRISPR Cascade.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
G31 A32 N33
Binding residue
(residue number reindexed from 1)
G31 A32 N33
Enzymatic activity
Enzyme Commision number ?
External links