Structure of PDB 8cef Chain J Binding Site BS01

Receptor Information

>8cef Chain J (length=88) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEIT
KRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYK

Ligand information

>8cef Chain A (length=26) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

atgtcaaggtcaccgtgacctttacg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8cef Asymmetric dimerization in a transcription factor superfamily is promoted by allosteric interactions with DNA.
Resolution	2.486 Å
Binding residue (original residue number in PDB)	E97 A98 R105 R128 K129 Q132 R135 R155 G156 G157 R158 K160
Binding residue (residue number reindexed from 1)	E23 A24 R31 R54 K55 Q58 R61 R81 G82 G83 R84 K86

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:8cef, PDBe:8cef, PDBj:8cef
PDBsum	8cef
PubMed	37503845
UniProt	O08580\|ERR1_MOUSE Steroid hormone receptor ERR1 (Gene Name=Esrra)

[Back to BioLiP]