Structure of PDB 8c8q Chain J Binding Site BS01

Receptor Information
>8c8q Chain J (length=75) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QFTFGTVGFDARFPNTNQTKHCFQSYIDYFRCIKAKGEDFVPCKQFWHAY
QSLCPMEWVERWDEQRENGTFPAPI
Ligand information
>8c8q Chain M (length=26) Species: 4896 (Schizosaccharomyces pombe) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8c8q Cryo-EM structure and function of S. pombe complex IV with bound respiratory supercomplex factor.
Resolution3.36 Å
Binding residue
(original residue number in PDB)		D39 F57
Binding residue
(residue number reindexed from 1)		D28 F46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004129 cytochrome-c oxidase activity
Biological Process
GO:0006119 oxidative phosphorylation
GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005758 mitochondrial intermembrane space
GO:0045277 respiratory chain complex IV

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8c8q, PDBe:8c8q, PDBj:8c8q
PDBsum8c8q
PubMed36797353
UniProtO94581|COX12_SCHPO Cytochrome c oxidase subunit 12, mitochondrial (Gene Name=cox12)

[Back to BioLiP]