Structure of PDB 7zyv Chain J Binding Site BS01

Receptor Information

>7zyv Chain J (length=159) Species: 3562 (Spinacia oleracea)

GVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACN
VGLAVLEPSMIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLM
ASVPAGLLTVPFLENVNKFQNPFRRPVATTVFLVGTVVALWLGIGATLPI
DKSLTLGLF

Ligand information

>7zyv Chain R (length=26) Species: 3562 (Spinacia oleracea)

KSFVDWLLGKITKEDQFYETDPILRG

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7zyv High-resolution cryo-EM structures of plant cytochrome b 6 f at work.
• Resolution: 2.13 Å
• Binding residue (original residue number in PDB): P7 K119 F120 Q121
• Binding residue (residue number reindexed from 1): P6 K118 F119 Q120

Gene Ontology

Molecular Function

• GO:0008121 ubiquinol-cytochrome-c reductase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0009507 chloroplast
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0042651 thylakoid membrane
• GO:0045275 respiratory chain complex III

External links

• PDB: RCSB:7zyv, PDBe:7zyv, PDBj:7zyv
• PDBsum: 7zyv
• PubMed: 36638176
• UniProt: P00166|PETD_SPIOL Cytochrome b6-f complex subunit 4 (Gene Name=petD)