Structure of PDB 7vd5 Chain J Binding Site BS01

Receptor Information

>7vd5 Chain J (length=34) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RIPLWLVGLVGGLAVITMLSLFFYGSYSGLGSSL

Ligand information

>7vd5 Chain F (length=28) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

FRWLAIHGLAIPTVFFLGGITAMQFIQR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7vd5 Structural basis for different types of hetero-tetrameric light-harvesting complexes in a diatom PSII-FCPII supercomplex
Resolution	2.5 Å
Binding residue (original residue number in PDB)	M23 F27 G34 L35 L39
Binding residue (residue number reindexed from 1)	M18 F22 G29 L30 L34

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009523	photosystem II
GO:0009539	photosystem II reaction center
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7vd5, PDBe:7vd5, PDBj:7vd5
PDBsum	7vd5
PubMed
UniProt	A0A679C298

[Back to BioLiP]