Structure of PDB 7sl5 Chain J Binding Site BS01

Receptor Information
>7sl5 Chain J (length=227) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLVQSGGGVVQPGSLRLSCSGSGFTFNNYIMHWVRQAPGQGLDYVSGIG
SDGRNTNYGDSVRFTISRDNSDTLYLQMTSLREDTAFYYCVKGLDVLRFL
DLSTPSGERLDAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAA
LGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS
SLGTQTYICNVNHKPSNTKVDKRVEPK
Ligand information
>7sl5 Chain L (length=12) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SKRSFIEDLLFN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7sl5 ACE2-binding exposes the SARS-CoV-2 fusion peptide to broadly neutralizing coronavirus antibodies.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		N31 S53 D54 N57 T58 N59 D101 L103
Binding residue
(residue number reindexed from 1)		N29 S51 D52 N55 T56 N57 D95 L97
External links