Structure of PDB 7r0w Chain J Binding Site BS01

Receptor Information

>7r0w Chain J (length=159) Species: 1148 (Synechocystis sp. PCC 6803)

SIIKKPDLSDPDLRAKLAKGMGHNYYGEPAWPNDILYMFPICILGALGLI
AGLAILDPAMIGEPADPFATPLEILPEWYLYPTFQILRILPNKLLGIAGM
AAIPLGLMLVPFIESVNKFQNPFRRPIAMTVFLFGTAAALWLGAGATFPI
DKSLTLGLF

Ligand information

>7r0w Chain P (length=29) Species: 1148 (Synechocystis sp. PCC 6803)

MDILTLGWVSVLVLFTWSISMVVWGRNGF

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7r0w Cryo-EM structures of the Synechocystis sp. PCC 6803 cytochrome b6f complex with and without the regulatory PetP subunit.
• Resolution: 2.8 Å
• Binding residue (original residue number in PDB): D35 M39 G49 L50 G53 L57
• Binding residue (residue number reindexed from 1): D34 M38 G48 L49 G52 L56

Gene Ontology

Molecular Function

• GO:0008121 ubiquinol-cytochrome-c reductase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity

Biological Process

• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0009512 cytochrome b6f complex
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane
• GO:0045275 respiratory chain complex III

External links

• PDB: RCSB:7r0w, PDBe:7r0w, PDBj:7r0w
• PDBsum: 7r0w
• PubMed: 35726684
• UniProt: P27589|PETD_SYNY3 Cytochrome b6-f complex subunit 4 (Gene Name=petD)