Structure of PDB 7pks Chain J Binding Site BS01

Receptor Information

>7pks Chain J (length=67) Species: 9825 (Sus scrofa domesticus)

MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLL
AHVDLIEKLLNYAPLEK

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 7pks Chain J Residue 101

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7pks Structural basis of Integrator-mediated transcription regulation.
• Resolution: 3.6 Å
• Binding residue (original residue number in PDB): C7 C10 C44 C45
• Binding residue (residue number reindexed from 1): C7 C10 C44 C45
• Annotation score: 1

Gene Ontology

Molecular Function

• GO:0001054 RNA polymerase I activity
• GO:0001055 RNA polymerase II activity
• GO:0001056 RNA polymerase III activity
• GO:0003677 DNA binding
• GO:0003899 DNA-directed 5'-3' RNA polymerase activity
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006351 DNA-templated transcription
• GO:0006360 transcription by RNA polymerase I
• GO:0006366 transcription by RNA polymerase II
• GO:0042797 tRNA transcription by RNA polymerase III

Cellular Component

• GO:0000428 DNA-directed RNA polymerase complex
• GO:0005665 RNA polymerase II, core complex
• GO:0005666 RNA polymerase III complex
• GO:0005736 RNA polymerase I complex

External links

• PDB: RCSB:7pks, PDBe:7pks, PDBj:7pks
• PDBsum: 7pks
• PubMed: 34762484
• UniProt: A0A7K6NXI9