Structure of PDB 7nyx Chain J Binding Site BS01

Receptor Information
>7nyx Chain J (length=135) Species: 230089 (Photorhabdus thracensis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKYQQLENLECGWKWAYLIRKHQEGEPITKYIENSAAHAAVDKLIKLESE
PVRVLEWIEQHMNPDLFNRMKQTIRARRKRHFNAEHQHTRKKSIDLDFPV
WHRLSALSQRRGNTLSETIVQLIEDAERKEKYANQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nyx Cryo-EM structure of MukBEF reveals DNA loop entrapment at chromosomal unloading sites.
Resolution4.6 Å
Binding residue
(original residue number in PDB)		M1 Y3 Q5 R75 R78 K79 K91 W101 T114 L115
Binding residue
(residue number reindexed from 1)		M1 Y3 Q5 R75 R78 K79 K91 W101 T114 L115
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0051301 cell division
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nyx, PDBe:7nyx, PDBj:7nyx
PDBsum7nyx
PubMed34739874
UniProtA0A0F7LUV5

[Back to BioLiP]