Structure of PDB 7fep Chain J Binding Site BS01

Receptor Information
>7fep Chain J (length=189) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLA
AEDPEKEISLYINSPGGSITAGMAIYDTMQFIKPKVSTICIGMAASMGAF
LLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNK
VLAERTGQPLEVIERDTDRDNFKSAEEALEYGLIDKILT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7fep Structural insights into ClpP protease side exit pore-opening by a pH drop coupled with substrate hydrolysis.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		R22 D26 Y62
Binding residue
(residue number reindexed from 1)		R21 D25 Y61
Enzymatic activity
Enzyme Commision number 3.4.21.92: endopeptidase Clp.
Gene Ontology
Molecular Function
GO:0004176 ATP-dependent peptidase activity
GO:0004252 serine-type endopeptidase activity
GO:0008236 serine-type peptidase activity
GO:0042802 identical protein binding
GO:0051117 ATPase binding
Biological Process
GO:0006508 proteolysis
GO:0006515 protein quality control for misfolded or incompletely synthesized proteins
Cellular Component
GO:0005737 cytoplasm
GO:0009368 endopeptidase Clp complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7fep, PDBe:7fep, PDBj:7fep
PDBsum7fep
PubMed35593068
UniProtP80244|CLPP_BACSU ATP-dependent Clp protease proteolytic subunit (Gene Name=clpP)

[Back to BioLiP]