Structure of PDB 7eda Chain J Binding Site BS01

Receptor Information
>7eda Chain J (length=36) Species: 32053 (Thermostichus vulcanus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL
Ligand information
>7eda Chain Y (length=27) Species: 32053 (Thermostichus vulcanus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AQLTMIAMIGIAGPMIIFLLAVRRGNL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7eda Cryo-EM structure of monomeric photosystem II at 2.78 angstrom resolution reveals factors important for the formation of dimer.
Resolution2.78 Å
Binding residue
(original residue number in PDB)		W11 I12
Binding residue
(residue number reindexed from 1)		W7 I8
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7eda, PDBe:7eda, PDBj:7eda
PDBsum7eda
PubMed34216574
UniProtQ7DGD4|PSBJ_THEVL Photosystem II reaction center protein J (Gene Name=psbJ)

[Back to BioLiP]