Structure of PDB 7ecw Chain J Binding Site BS01

Receptor Information
>7ecw Chain J (length=124) Species: 1647551 (Moraxella phage Mcat5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKKIEMIEISQNRQNLTAFLHISEIKAINAKLADGVDVDKKSFDEICSIV
LEQYQAKQISNKQASEIFETLAKANKSFKIEKFRCSHGYNEIYKYSPDHE
AYLFYCKGGQGQLNKLIAENGRFM
Ligand information
>7ecw Chain M (length=44) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cuaagaaauucacggcgggcuugauguccgcgucuaccugguuc
............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ecw Insights into the dual functions of AcrIF14 during the inhibition of type I-F CRISPR-Cas surveillance complex.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Y89 K107
Binding residue
(residue number reindexed from 1)		Y89 K107
Enzymatic activity
Enzyme Commision number ?
External links