Structure of PDB 7d1u Chain J Binding Site BS01

Receptor Information
>7d1u Chain J (length=36) Species: 32053 (Thermostichus vulcanus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL
Ligand information
>7d1u Chain Y (length=27) Species: 32053 (Thermostichus vulcanus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AQLTMIAMIGIAGPMIIFLLAVRRGNL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7d1u High-resolution cryo-EM structure of photosystem II reveals damage from high-dose electron beams.
Resolution2.08 Å
Binding residue
(original residue number in PDB)		W11 I12
Binding residue
(residue number reindexed from 1)		W7 I8
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7d1u, PDBe:7d1u, PDBj:7d1u
PDBsum7d1u
PubMed33753866
UniProtQ7DGD4|PSBJ_THEVL Photosystem II reaction center protein J (Gene Name=psbJ)

[Back to BioLiP]