Structure of PDB 7c06 Chain J Binding Site BS01

Receptor Information

>7c06 Chain J (length=193) Species: 284812 (Schizosaccharomyces pombe 972h-)

ASHLASIYGTEQDKVNCSFYYKIGACRHGERCSRKHVKPNFSQTILCPNM
YKNPIHEPNGKKFTQRELAEQFDAFYEDMFCEFSKYGEVEQLVVCDNVGD
HLVGNVYVRFKYEESAQNAIDDLNSRWYSQRPVYAELSPVTDFREACCRQ
HETSECQRGGLCNFMHAKKPSPQLLRDLVLAQRKYLALNAAEE

Ligand information

>7c06 Chain L (length=5)

uaggu

.....

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7c06 Elucidation of the aberrant 3' splice site selection by cancer-associated mutations on the U2AF1.
• Resolution: 3.02 Å
• Binding residue (original residue number in PDB): T11 E12 K15 F20 K23 R28 H29 C33 S34 R35 E146 C148 C149 R150 Q151 R159 C163 N164 F165
• Binding residue (residue number reindexed from 1): T10 E11 K14 F19 K22 R27 H28 C32 S33 R34 E145 C147 C148 R149 Q150 R158 C162 N163 F164

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0030628 pre-mRNA 3'-splice site binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000389 mRNA 3'-splice site recognition
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0045292 mRNA cis splicing, via spliceosome

Cellular Component

• GO:0000243 commitment complex
• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005829 cytosol
• GO:0071004 U2-type prespliceosome
• GO:0089701 U2AF complex

External links

• PDB: RCSB:7c06, PDBe:7c06, PDBj:7c06
• PDBsum: 7c06
• PubMed: 32958768
• UniProt: Q09176|U2AF1_SCHPO Splicing factor U2AF 23 kDa subunit (Gene Name=SPAP8A3.06)