Structure of PDB 7bwn Chain J Binding Site BS01

Receptor Information
>7bwn Chain J (length=280) Species: 6100,9606 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTT
GKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISF
KDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNV
YITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHY
LSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYKKLGGEYFTLQIR
GRERFEEFREKNEALELKDAQAGGTCFNAS
Ligand information
>7bwn Chain K (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EYFTLQIRGRERFEEFREKNEALELKDA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bwn Cellular Synthesis and X-ray Crystal Structure of a Designed Protein Heterocatenane.
Resolution2.396 Å
Binding residue
(original residue number in PDB)
K156 D197 Y237 L240 E243 Y244 F245 T246 L247 Q248 I249 R250 G251 R252 R254 F255 F258 R259 N262 D269 F277
Binding residue
(residue number reindexed from 1)
K156 D197 Y237 L240 E243 Y244 F245 T246 L247 Q248 I249 R250 G251 R252 R254 F255 F258 R259 N262 D269 F277
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
Biological Process
GO:0006091 generation of precursor metabolites and energy
GO:0008218 bioluminescence
GO:0051262 protein tetramerization
Cellular Component
GO:0005575 cellular_component

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7bwn, PDBe:7bwn, PDBj:7bwn
PDBsum7bwn
PubMed32506656
UniProtP04637|P53_HUMAN Cellular tumor antigen p53 (Gene Name=TP53);
P42212|GFP_AEQVI Green fluorescent protein (Gene Name=GFP)

[Back to BioLiP]