Structure of PDB 7bwn Chain J Binding Site BS01

Receptor Information

>7bwn Chain J (length=280) Species: 6100,9606 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTT
GKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISF
KDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNV
YITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHY
LSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYKKLGGEYFTLQIR
GRERFEEFREKNEALELKDAQAGGTCFNAS

Ligand information

>7bwn Chain K (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EYFTLQIRGRERFEEFREKNEALELKDA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7bwn Cellular Synthesis and X-ray Crystal Structure of a Designed Protein Heterocatenane.
Resolution	2.396 Å
Binding residue (original residue number in PDB)	K156 D197 Y237 L240 E243 Y244 F245 T246 L247 Q248 I249 R250 G251 R252 R254 F255 F258 R259 N262 D269 F277
Binding residue (residue number reindexed from 1)	K156 D197 Y237 L240 E243 Y244 F245 T246 L247 Q248 I249 R250 G251 R252 R254 F255 F258 R259 N262 D269 F277

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003674	molecular_function

	Biological Process
GO:0006091	generation of precursor metabolites and energy
GO:0008218	bioluminescence
GO:0051262	protein tetramerization

	Cellular Component
GO:0005575	cellular_component

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7bwn, PDBe:7bwn, PDBj:7bwn
PDBsum	7bwn
PubMed	32506656
UniProt	P04637\|P53_HUMAN Cellular tumor antigen p53 (Gene Name=TP53); P42212\|GFP_AEQVI Green fluorescent protein (Gene Name=GFP)

[Back to BioLiP]