Structure of PDB 6zbu Chain J Binding Site BS01

Receptor Information
>6zbu Chain J (length=132) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPSSDLYLRPGGGDSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQ
FRAHKTVLMACSGLFYSIFTDQLKRNLSVINLDPEINPEGFNILLDFMYT
SRLNLREGNIMAVMATAMYLQMEHVVDTCRKF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zbu Functionalization of the BCL6 BTB domain into a noncovalent crystallization chaperone.
Resolution2.46 Å
Binding residue
(original residue number in PDB)		S7 Q8 I9 Q10 F11 T12 R13 H14 D17 V18 N21 R24 R28
Binding residue
(residue number reindexed from 1)		S15 Q16 I17 Q18 F19 T20 R21 H22 D25 V26 N29 R32 R36
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6zbu, PDBe:6zbu, PDBj:6zbu
PDBsum6zbu
PubMed33708392
UniProtO75376;
P41182|BCL6_HUMAN B-cell lymphoma 6 protein (Gene Name=BCL6)

[Back to BioLiP]