Structure of PDB 6whi Chain J Binding Site BS01

Receptor Information
>6whi Chain J (length=64) Species: 102862 (Proteus penneri) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STYIIKEVQNINSDREGVKVETTSLTSAKRIASKNQFFHGTVLRIESESG
NWLAYKEDGKRWIE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6whi AcrIF9 tethers non-sequence specific dsDNA to the CRISPR RNA-guided surveillance complex.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		R32 S35 K36
Binding residue
(residue number reindexed from 1)		R30 S33 K34
External links