Structure of PDB 6tlj Chain J Binding Site BS01

Receptor Information
>6tlj Chain J (length=504) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTA
QYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMSQSSIK
SSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQ
EEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQE
NLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELN
KANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTL
EKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYG
LTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDAL
EKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNA
STYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGD
SEAY
Ligand information
>6tlj Chain G (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MLRRKPTRLELKLDDIEEFENIRKD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tlj A unique binding mode of Nek2A to the APC/C allows its ubiquitination during prometaphase.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		H174 Y212 Y243 C245 E277 H342 Y373 E377 F403 H406 V410 F413 K443 E445 P446 N449 N450 H453 R456 K457 K459 N478 S480 A484 Y487 S490 L491 F514 M518 M525
Binding residue
(residue number reindexed from 1)		H145 Y183 Y214 C216 E248 H313 Y344 E348 F374 H377 V381 F384 K414 E416 P417 N420 N421 H424 R427 K428 K430 N449 S451 A455 Y458 S461 L462 F485 M489 M496
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0007346 regulation of mitotic cell cycle
GO:0016567 protein ubiquitination
GO:0031145 anaphase-promoting complex-dependent catabolic process
GO:0045842 positive regulation of mitotic metaphase/anaphase transition
GO:0051301 cell division
GO:0051445 regulation of meiotic cell cycle
GO:0070936 protein K48-linked ubiquitination
GO:0070979 protein K11-linked ubiquitination
GO:0141198 protein branched polyubiquitination
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005680 anaphase-promoting complex
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005819 spindle
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0072686 mitotic spindle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tlj, PDBe:6tlj, PDBj:6tlj
PDBsum6tlj
PubMed32307883
UniProtQ13042|CDC16_HUMAN Cell division cycle protein 16 homolog (Gene Name=CDC16)

[Back to BioLiP]