Structure of PDB 6qxf Chain J Binding Site BS01

Receptor Information
>6qxf Chain J (length=287) Species: 1308 (Streptococcus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GWRTVVVNIHSKLSYKNNHLIFRNSYKTEMIHLSEIDILLLETTDIVLTT
MLVKRLVDENILVIFCDDKRLPTAFLTPYYARHDSSLQIARQIAWKENVK
CEVWTAIIAQKILNQSYYLGECSFFEKSQSIMELYHGLERFDPSNREGHS
ARIYFNTLFGNDFTRESDNDINAALDYGYTLLLSMFAREVVVCGCMTQIG
LKHANQFNQFNLASDIMEPFRPIIDRIVYQNRHNNFVKIKKELFSIFSET
YLYNGKEMYLSNIVSDYTKKVIKALNQLGEEIPEFRI
Ligand information
>6qxf Chain K (length=11) Species: 1308 (Streptococcus thermophilus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EERLVFLGDNY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qxf Structure of the DNA-Bound Spacer Capture Complex of a Type II CRISPR-Cas System.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		W4 R5 T6 V7 V8 N10 I11 F24 E44 R72 F246 Y261
Binding residue
(residue number reindexed from 1)		W2 R3 T4 V5 V6 N8 I9 F22 E42 R70 F244 Y259
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0004520 DNA endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6qxf, PDBe:6qxf, PDBj:6qxf
PDBsum6qxf
PubMed31080012
UniProtG3ECR2|CAS1_STRTR CRISPR-associated endonuclease Cas1 (Gene Name=cas1)

[Back to BioLiP]