Structure of PDB 6k0b Chain J Binding Site BS01

Receptor Information
>6k0b Chain J (length=116) Species: 243232 (Methanocaldococcus jannaschii DSM 2661) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVYVKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAED
VKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGD
AEELKVLIEKVNVLKQ
Ligand information
>6k0b Chain Y (length=258) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggagggggcuggugacuuuccccucuuuaagaggggaggaaguuccgccc
accccauuuaugggcagcguccccugagaaggggcgggagaugcagcaga
aacgacacggcuccggaagagaugacgaugauagugaaaguugaggacuu
ccggagaaccggugaaacgggcaucuccccugcccggggugcaagccggu
uucggcgcuuagccgaaugucaccgaaauuacagaaggcgggcuauagcc
cccauuuu
<<.<<<<<<<<<<<<<...<<<<<<<...>>>>>>>......[.(((((<
<<<<<......<<<<<....<<<<<....>>>>>.<<<<<<<<<......
.......<<<<<<<<<<<.......<...................>..>>
>>>>>>..>>>.........>>>>>>>>>.>>>>>>>>>>>...<<<<..
..>>>>............>>>>>>............)))))]....>>>>
>>>.>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6k0b Cryo-electron microscopy structure of an archaeal ribonuclease P holoenzyme.
Resolution4.3 Å
Binding residue
(original residue number in PDB)		K29 G30 N32 E33 K36 V52 K53 K78 L87 V89 A91 S92
Binding residue
(residue number reindexed from 1)		K28 G29 N31 E32 K35 V51 K52 K77 L86 V88 A90 S91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0034512 box C/D sno(s)RNA binding
Biological Process
GO:0000492 box C/D snoRNP assembly
GO:0001682 tRNA 5'-leader removal
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0031428 box C/D methylation guide snoRNP complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6k0b, PDBe:6k0b, PDBj:6k0b
PDBsum6k0b
PubMed31197137
UniProtP54066|RL7A_METJA Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]