Structure of PDB 6hc3 Chain J Binding Site BS01

Receptor Information
>6hc3 Chain J (length=191) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPD
SKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAM
TKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLS
DSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hc3 DNA specificities modulate the binding of human transcription factor A to mitochondrial DNA control region.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
K51 K52 V54 L58 K62 R140 K146 K147 R157 Y162 Q179 L182 K186 Y211 R232 R233 T234
Binding residue
(residue number reindexed from 1)
K8 K9 V11 L15 K19 R97 K103 K104 R114 Y119 Q136 L139 K143 Y168 R189 R190 T191
Binding affinityPDBbind-CN: Kd=13.6nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6hc3, PDBe:6hc3, PDBj:6hc3
PDBsum6hc3
PubMed31114891
UniProtQ00059|TFAM_HUMAN Transcription factor A, mitochondrial (Gene Name=TFAM)

[Back to BioLiP]