Structure of PDB 6edt Chain J Binding Site BS01

Receptor Information
>6edt Chain J (length=109) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDAEIPG
TWLCRNGMEGTLIEGDLPEPKKVKPPRTHWDMLLERRSIEELEELLKERL
ELIRSRRRG
Ligand information
>6edt Chain P (length=65) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcccgcttcggggcaaccctgccagtctaatacaaatccggcaatggag
tcaagaccaggttcg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6edt Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
ResolutionN/A
Binding residue
(original residue number in PDB)		R4 V5 L6
Binding residue
(residue number reindexed from 1)		R2 V3 L4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001000 bacterial-type RNA polymerase core enzyme binding
GO:0001108 bacterial-type RNA polymerase holo enzyme binding
GO:0003676 nucleic acid binding
GO:0005515 protein binding
Biological Process
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6edt, PDBe:6edt, PDBj:6edt
PDBsum6edt
PubMed30626968
UniProtP9WHJ5|RBPA_MYCTU RNA polymerase-binding protein RbpA (Gene Name=rbpA)

[Back to BioLiP]