Structure of PDB 6c2f Chain J Binding Site BS01

Receptor Information
>6c2f Chain J (length=67) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL
GNTVDLSSFDFRTGKMM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c2f MBD2 in complex with methylated DNA
Resolution2.65 Å
Binding residue
(original residue number in PDB)		R188 S189 K190 P191 R209
Binding residue
(residue number reindexed from 1)		R41 S42 K43 P44 R62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6c2f, PDBe:6c2f, PDBj:6c2f
PDBsum6c2f
PubMed
UniProtQ9UBB5|MBD2_HUMAN Methyl-CpG-binding domain protein 2 (Gene Name=MBD2)

[Back to BioLiP]