Structure of PDB 6bb4 Chain J Binding Site BS01

Receptor Information

>6bb4 Chain J (length=216) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QVQLQQSDAELVKPGASVKISCKASGYTFTDRTIHWVKQRPEQGLEWIGY
IYPGDDSTKYNDMFKAKATLTADKSSNTAYMQLNSLTSDDSAVYFCARRG
TMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPE
PVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVA
HPASSTKVDKKIVPRD

Ligand information

>6bb4 Chain R (length=7) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

IVYKSPV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6bb4 Tau Antibody Structure Reveals a Molecular Switch Defining a Pathological Conformation of the Tau Protein.
Resolution	2.099 Å
Binding residue (original residue number in PDB)	T33 Y52 R95 G96 T97
Binding residue (residue number reindexed from 1)	T33 Y52 R99 G100 T101

External links

PDB	RCSB:6bb4, PDBe:6bb4, PDBj:6bb4
PDBsum	6bb4
PubMed	29670132

[Back to BioLiP]