Structure of PDB 5wha Chain J Binding Site BS01

Receptor Information
>5wha Chain J (length=151) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TEYKLVVVGAVGVGKSALTIQLIQSYRKQVVIDGETCLLDILDTAGQEEY
SAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLV
GNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIR
K
Ligand information
>5wha Chain K (length=29) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RPRCPGDDASIEDLHEYWARLWNYLYAVA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wha Exceptionally high-affinity Ras binders that remodel its effector domain.
Resolution2.04 Å
Binding residue
(original residue number in PDB)		K5 Y40 R41 I55 L56 D57 T58 E63 R68 Y71
Binding residue
(residue number reindexed from 1)		K4 Y26 R27 I41 L42 D43 T44 E49 R54 Y57
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005525 GTP binding
Biological Process
GO:0007165 signal transduction
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5wha, PDBe:5wha, PDBj:5wha
PDBsum5wha
PubMed29282294
UniProtP01116|RASK_HUMAN GTPase KRas (Gene Name=KRAS)

[Back to BioLiP]