Structure of PDB 5mp1 Chain J Binding Site BS01

Receptor Information
>5mp1 Chain J (length=214) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLQQSGPELVKPGTSVKMPCKASGYIFTDYVISWVKQRTGQGLEWIGEI
FPRSGSTYYNEKFKGKATLTADKSSNTAYMQLSSVTSEDSAVYFCARDYY
GTSFAMDYWGQGTSVTVSSAKTTPPSVYPLAPGNSMVTLGCLVKGYFPEP
VTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAH
PASSTKVDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mp1 Crystal structure of DC8E8 Fab in the complex with a 14-mer tau peptide at pH 7.5
Resolution3.1 Å
Binding residue
(original residue number in PDB)
V33 E50 F52 S57 Y59 Y101
Binding residue
(residue number reindexed from 1)
V32 E49 F51 S56 Y58 Y100
External links