Structure of PDB 5j0n Chain J Binding Site BS01

Receptor Information
>5j0n Chain J (length=94) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGS
FSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG
Ligand information
>5j0n Chain A (length=197) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gtcggcatagtgactgcatatgttgtgttttacagtattatgtagtctgt
tttttatgcaaaatctaatttaatatattgatatttatatcattttacgt
ttctcgttcagctttaatacaataagttggaattctaaaaaagcattgct
tatcaatttgttgcaacgaacaggtcactatcagtcaaaatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5j0n Structure of a Holliday junction complex reveals mechanisms governing a highly regulated DNA transaction.
Resolution11.0 Å
Binding residue
(original residue number in PDB)		R46 H54 R56 R59 P64
Binding residue
(residue number reindexed from 1)		R46 H54 R56 R59 P64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006310 DNA recombination
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0006417 regulation of translation
Cellular Component
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:1990177 IHF-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5j0n, PDBe:5j0n, PDBj:5j0n
PDBsum5j0n
PubMed27223329
UniProtP0A6Y1|IHFB_ECOLI Integration host factor subunit beta (Gene Name=ihfB)

[Back to BioLiP]