Structure of PDB 5h9e Chain J Binding Site BS01

Receptor Information
>5h9e Chain J (length=219) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRSYLILRLAGPMQAWGQPTFEGTRPTGRFPTRSGLLGLLGACLGIQRDD
TSSLQALSESVQFAVRCDELILDDRRVSVTGLRDYHTVLGAREDYRGLKS
HETIQTWREYLCDASFTVALWLTPHATMVISELEKAVLKPRYTPYLGRRS
CPLTHPLFLGTCQASDPQKALLNYEPVGGDIYSEESVTGHHLKFTARDEP
MITLPRQFASREWYVIKGG
Ligand information
>5h9e Chain L (length=61) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auaaaccgacgguauuguucagauccuggcuugccaacaggaguuccccg
cgccagcgggg
..............................................<<<<
<....>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5h9e Structural basis for promiscuous PAM recognition in type I-E Cascade from E. coli.
Resolution3.21 Å
Binding residue
(original residue number in PDB)
W16 Q18 P19 T20 R25 S34 G35 G38 L39 G41 A42 I46 R48 Y85 H86 T87 V88 L89 R92 R108 Y142 P144 Y145 G147 R148 R149 R197 R206 F208
Binding residue
(residue number reindexed from 1)
W16 Q18 P19 T20 R25 S34 G35 G38 L39 G41 A42 I46 R48 Y85 H86 T87 V88 L89 R92 R108 Y142 P144 Y145 G147 R148 R149 R197 R206 F208
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0071667 DNA/RNA hybrid binding
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus
GO:0099048 CRISPR-cas system
Cellular Component
GO:0032991 protein-containing complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5h9e, PDBe:5h9e, PDBj:5h9e
PDBsum5h9e
PubMed26863189
UniProtQ46898|CAS5_ECOLI CRISPR system Cascade subunit CasD (Gene Name=casD)

[Back to BioLiP]