Structure of PDB 5h9e Chain J Binding Site BS01

Receptor Information

>5h9e Chain J (length=219) Species: 83333 (Escherichia coli K-12)

MRSYLILRLAGPMQAWGQPTFEGTRPTGRFPTRSGLLGLLGACLGIQRDD
TSSLQALSESVQFAVRCDELILDDRRVSVTGLRDYHTVLGAREDYRGLKS
HETIQTWREYLCDASFTVALWLTPHATMVISELEKAVLKPRYTPYLGRRS
CPLTHPLFLGTCQASDPQKALLNYEPVGGDIYSEESVTGHHLKFTARDEP
MITLPRQFASREWYVIKGG

Ligand information

>5h9e Chain L (length=61)

auaaaccgacgguauuguucagauccuggcuugccaacaggaguuccccg
cgccagcgggg

..............................................<<<<
<....>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5h9e Structural basis for promiscuous PAM recognition in type I-E Cascade from E. coli.
• Resolution: 3.21 Å
• Binding residue (original residue number in PDB): W16 Q18 P19 T20 R25 S34 G35 G38 L39 G41 A42 I46 R48 Y85 H86 T87 V88 L89 R92 R108 Y142 P144 Y145 G147 R148 R149 R197 R206 F208
• Binding residue (residue number reindexed from 1): W16 Q18 P19 T20 R25 S34 G35 G38 L39 G41 A42 I46 R48 Y85 H86 T87 V88 L89 R92 R108 Y142 P144 Y145 G147 R148 R149 R197 R206 F208

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0071667 DNA/RNA hybrid binding

Biological Process

• GO:0043571 maintenance of CRISPR repeat elements
• GO:0051607 defense response to virus
• GO:0099048 CRISPR-cas system

Cellular Component

• GO:0032991 protein-containing complex

External links

• PDB: RCSB:5h9e, PDBe:5h9e, PDBj:5h9e
• PDBsum: 5h9e
• PubMed: 26863189
• UniProt: Q46898|CAS5_ECOLI CRISPR system Cascade subunit CasD (Gene Name=casD)