Structure of PDB 5eoc Chain J Binding Site BS01

Receptor Information

>5eoc Chain J (length=214) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VQLQQPGAELVRPGGSVKLSCKASGYSFTTYWMMWVKQRPGQGLEWIGMI
QPSDSETRLNQKFKDKATLTLDRSSSTVYMQLSSPTSDDSAVYYCARTGR
GDAWLTYWGQGTSVTVSSAKTTPPSVYPLAPGSNSMVTLGCLVKGYFPEP
VTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAH
PASSTKVDKKIVPR

Ligand information

>5eoc Chain Q (length=13) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

CQLINTNGSWHIC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5eoc Generation and Characterization of Monoclonal Antibodies against a Cyclic Variant of Hepatitis C Virus E2 Epitope 412-422.
Resolution	1.98 Å
Binding residue (original residue number in PDB)	R59 R101 G102 D103
Binding residue (residue number reindexed from 1)	R58 R100 G101 D102

External links

PDB	RCSB:5eoc, PDBe:5eoc, PDBj:5eoc
PDBsum	5eoc
PubMed	26819303

[Back to BioLiP]