Structure of PDB 5clv Chain J Binding Site BS01

Receptor Information

>5clv Chain J (length=63) Species: 562 (Escherichia coli)

KRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAVS
QAVHRVWAAFEDK

Ligand information

>5clv Chain K (length=20)

ccaagtttagctaaacttgg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5clv Flexibility of KorA, a plasmid-encoded, global transcription regulator, in the presence and the absence of its operator.
• Resolution: 2.5 Å
• Binding residue (original residue number in PDB): E18 V19 G20 Q22 T23 T47 Q53 R57
• Binding residue (residue number reindexed from 1): E16 V17 G18 Q20 T21 T45 Q51 R55

External links

• PDB: RCSB:5clv, PDBe:5clv, PDBj:5clv
• PDBsum: 5clv
• PubMed: 27016739
• UniProt: P03052|KORA2_ECOLX TrfB transcriptional repressor protein (Gene Name=trfB)