Structure of PDB 5bqq Chain J Binding Site BS01

Receptor Information
>5bqq Chain J (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPGH
Ligand information
>5bqq Chain B (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FVNQHLCGSHLVEALYLVCGERGFFYT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5bqq Rational steering of insulin binding specificity by intra-chain chemical crosslinking.
Resolution1.54 Å
Binding residue
(original residue number in PDB)
N3 H10
Binding residue
(residue number reindexed from 1)
N3 H10
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:5bqq, PDBe:5bqq, PDBj:5bqq
PDBsum5bqq
PubMed26792393
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]