Structure of PDB 4u0b Chain J Binding Site BS01

Receptor Information
>4u0b Chain J (length=198) Species: 11698 (Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQ
DLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPPRGSDIAGTTSTLQE
QIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRD
YVDRFYKTLRAEQTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4u0b Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		N53 L56 N57 M66 Q67 K70 N74 T107 T108
Binding residue
(residue number reindexed from 1)		N53 L56 N57 M66 Q67 K70 N74 T94 T95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Biological Process
External links
PDB RCSB:4u0b, PDBe:4u0b, PDBj:4u0b
PDBsum4u0b
PubMed25356722
UniProtP12493|GAG_HV1N5 Gag polyprotein (Gene Name=gag)

[Back to BioLiP]