Structure of PDB 4qyz Chain J Binding Site BS01

Receptor Information

>4qyz Chain J (length=195) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MRSYLILRLAGPMQAWGQPTGTRPTGRFPTRSGLLGLLGACLGIQRDDTS
SLQALSESVQFAVRCDELILRRVSVTGLRDYHTVLIQTWREYLCDASFTV
ALWLTPHATMVISELEKAVLKPRYTPYLGRRSCPLTHPLFLGTCQPQKAL
LNYEPVGGDIYSEESVHLKFTARDEPMITLPRQFASREWYVIKGG

Ligand information

>4qyz Chain L (length=55) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

auaaaccgccagugauaaguggaaugccaugugggcugucgaguucccgg
ccggg

.............................................<<<<.
.>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4qyz Structural biology. Crystal structure of a CRISPR RNA-guided surveillance complex bound to a ssDNA target.
Resolution	3.0303 Å
Binding residue (original residue number in PDB)	G17 Q18 P19 R25 S34 G35 G38 L39 A42 I46 Q47 R48 Y85 H86 T87 R108 Y142 P144 Y145 G147 R148 R149 R197 R206 F208
Binding residue (residue number reindexed from 1)	G17 Q18 P19 R23 S32 G33 G36 L37 A40 I44 Q45 R46 Y81 H82 T83 R90 Y124 P126 Y127 G129 R130 R131 R173 R182 F184

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding
GO:0071667	DNA/RNA hybrid binding

	Biological Process
GO:0043571	maintenance of CRISPR repeat elements
GO:0051607	defense response to virus
GO:0099048	CRISPR-cas system

	Cellular Component
GO:0032991	protein-containing complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4qyz, PDBe:4qyz, PDBj:4qyz
PDBsum	4qyz
PubMed	25123481
UniProt	Q46898\|CAS5_ECOLI CRISPR system Cascade subunit CasD (Gene Name=casD)

[Back to BioLiP]