Structure of PDB 4pbu Chain J Binding Site BS01

Receptor Information
>4pbu Chain J (length=38) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL
Ligand information
>4pbu Chain Y (length=29) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VIAQLTMIAMIGIAGPMIIFLLAVRRGNL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pbu Serial time-resolved crystallography of photosystem II using a femtosecond X-ray laser.
Resolution5.0 Å
Binding residue
(original residue number in PDB)		W11 I12
Binding residue
(residue number reindexed from 1)		W9 I10
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4pbu, PDBe:4pbu, PDBj:4pbu
PDBsum4pbu
PubMed25043005
UniProtP59087|PSBJ_THEVB Photosystem II reaction center protein J (Gene Name=psbJ)

[Back to BioLiP]