Structure of PDB 4by9 Chain J Binding Site BS01

Receptor Information

>4by9 Chain J (length=121) Species: 2261 (Pyrococcus furiosus)

KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVI
IAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAII
EPGKARDLVEEIAMKVKELMK

Ligand information

>4by9 Chain A (length=72)

gcgagcaaugaugagugaugggcgaacugagcucgaaagagcaaugauga
gugaugggcgaacugagcucgc

<<<<<<....<...................<<<<....>>>>........
.............>..>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4by9 The Structure of the Box C/D Enzyme Reveals Regulation of RNA Methylation.
• Resolution: N/A
• Binding residue (original residue number in PDB): R31 K32 G33 T34 N35 E36 K39 R43 Q45 V55 D56 I60 K81 I90 V92 A93 A94 A95
• Binding residue (residue number reindexed from 1): R31 K32 G33 T34 N35 E36 K39 R43 Q45 V55 D56 I60 K81 I90 V92 A93 A94 A95

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0004526 ribonuclease P activity
• GO:0019843 rRNA binding

Biological Process

• GO:0001682 tRNA 5'-leader removal
• GO:0006364 rRNA processing
• GO:0006412 translation
• GO:0008033 tRNA processing
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4by9, PDBe:4by9, PDBj:4by9
• PDBsum: 4by9
• PubMed: 24121435
• UniProt: Q8U160|RL7A_PYRFU Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)