Structure of PDB 3zqc Chain J Binding Site BS01

Receptor Information
>3zqc Chain J (length=119) Species: 5722 (Trichomonas vaginalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKGPFTEAEDDLIREYVKENGPQNWPRITSFLPNRSPKQCRERWFNHLDP
AVVKHAWTPEEDETIFRNYLKLGSKWSVIAKLIPGRTDNAIKNRWNSSIS
KRISTNSNHKEILLPDRSK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zqc Structure of the Trichomonas Vaginalis Myb3 DNA-Binding Domain Bound to a Promoter Sequence Reveals a Unique C-Terminal Beta-Hairpin Conformation.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		P55 F56 K89 Q90 E93 R94 H98 N144 S148 K170
Binding residue
(residue number reindexed from 1)		P4 F5 K38 Q39 E42 R43 H47 N93 S97 K119
Enzymatic activity
Enzyme Commision number ?
External links