Structure of PDB 3wut Chain J Binding Site BS01

Receptor Information
>3wut Chain J (length=44) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTET
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3wut Structural and biochemical insights into the role of testis-expressed gene 14 (TEX14) in forming the stable intercellular bridges of germ cells.
Resolution2.301 Å
Binding residue
(original residue number in PDB)		A177 K180 Q183 W184 Y187 Q190 R191 Y194
Binding residue
(residue number reindexed from 1)		A10 K13 Q16 W17 Y20 Q23 R24 Y27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000281 mitotic cytokinesis
GO:0051896 regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

View graph for
Biological Process
External links
PDB RCSB:3wut, PDBe:3wut, PDBj:3wut
PDBsum3wut
PubMed26392564
UniProtQ53EZ4|CEP55_HUMAN Centrosomal protein of 55 kDa (Gene Name=CEP55)

[Back to BioLiP]