Structure of PDB 3tbt Chain J Binding Site BS01

Receptor Information
>3tbt Chain J (length=268) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAP
WMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSG
CDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQS
GAAEHYKAYLEGECVEWLHRYLKNGNRTDSPKAHVTHHPRSKGEVTLRCW
ALGFYPADITLTWQLGEELMELVETRPAGDGTFQKWASVVVPLGKEQNYT
CRVYHEGLPEPLTLRWEP
Ligand information
>3tbt Chain L (length=9) Species: 11627 (Lymphocytic choriomeningitis virus (strain WE)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KAPSNFATM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3tbt Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
Resolution2.3 Å
Binding residue
(original residue number in PDB)		Y7 R62 E63 K66 Q70 W73 S77 N80 Y84 L95 Q97 F116 T143 K146 W147 H155 Y156 Y159 E163 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 R62 E63 K66 Q70 W73 S77 N80 Y84 L95 Q97 F116 T143 K146 W147 H155 Y156 Y159 E163 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3tbt, PDBe:3tbt, PDBj:3tbt
PDBsum3tbt
PubMed
UniProtP01899|HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain (Gene Name=H2-D1)

[Back to BioLiP]